SCOPe 2.08: Domain d3reua_: 3reu A:

Lineage for d3reua_ (3reu A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein automated matches [193659] (8 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [193660] (6 PDB entries)

8. Domain d3reua_: 3reu A: [215780]
   automated match to d3p8vb_
   complexed with asp, atp, mg

Details for d3reua_

PDB Entry: 3reu, 1.9 Å

PDB Description: Crystal structure of the archaeal asparagine synthetase A complexed with L-Aspartic acid and Adenosine triphosphate

PDB Compounds: (A:) AsnS-like asparaginyl-tRNA synthetase related protein

SCOPe Domain Sequences for d3reua_:

Sequence; same for both SEQRES and ATOM records:

>d3reua_ d.104.1.1 (A:) automated matches {Pyrococcus abyssi [TaxId: 29292]}
mnaveiisrdiykaidiqtkildymtkfftdrgfkwllpimlspitdplwpdpagegirp
aevdvygvrmrlthsmilhkqlaiamglekifvlspnirlesrrkddgrhsyeftqldfe
iegakmkdvmrlieeliyglfrkaeewtgrefprarhfkvydykdileefgsdekasmem
eepfwivniprefydreengvwknydlilpygygevssggereweyekivakiraaglke
dsfrpyleiaragklkpsagagigverlvrfivgakhiaevqpfprvpgipavi

Timeline for d3reua_:

• d3reua_ first appeared in SCOPe 2.03
  
• d3reua_ appears in SCOPe 2.07