Lineage for d3refb_ (3ref B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849797Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [226210] (4 PDB entries)
  8. 1849801Domain d3refb_: 3ref B: [215773]
    automated match to d1hh4a_
    complexed with gdp, mg, so4

Details for d3refb_

PDB Entry: 3ref (more details), 1.95 Å

PDB Description: Crystal structure of EhRho1 bound to GDP and Magnesium
PDB Compounds: (B:) Rho-like small GTPase

SCOPe Domain Sequences for d3refb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3refb_ c.37.1.0 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
gkiengkkalkivvvgdgavgktclllafskgeiptayvptvfenfshvmkykneefilh
lwdtagqeeydrlrplsyadsdvvllcfavnnrtsfdnistkwepeikhyidtaktvlvg
lkvdlrkdgsddvtkqegddlcqklgcvayieassvakiglnevfeksvdcifsnkpvpk

SCOPe Domain Coordinates for d3refb_:

Click to download the PDB-style file with coordinates for d3refb_.
(The format of our PDB-style files is described here.)

Timeline for d3refb_: