SCOPe 2.08: Domain d3refa_: 3ref A:

Lineage for d3refa_ (3ref A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [196360] (4 PDB entries)

8. Domain d3refa_: 3ref A: [215772]
   automated match to d1hh4a_
   complexed with gdp, mg, so4

Details for d3refa_

PDB Entry: 3ref, 1.95 Å

PDB Description: Crystal structure of EhRho1 bound to GDP and Magnesium

PDB Compounds: (A:) Rho-like small GTPase

SCOPe Domain Sequences for d3refa_:

Sequence; same for both SEQRES and ATOM records:

>d3refa_ c.37.1.8 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
gkiengkkalkivvvgdgavgktclllafskgeiptayvptvfenfshvmkykneefilh
lwdtagqeeydrlrplsyadsdvvllcfavnnrtsfdnistkwepeikhyidtaktvlvg
lkvdlrkdgsddvtkqegddlcqklgcvayieassvakiglnevfeksvdcif

Timeline for d3refa_:

• d3refa_ first appeared in SCOPe 2.03
  
• d3refa_ appears in SCOPe 2.07