![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein T-cell antigen receptor [49125] (6 species) |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (10 PDB entries) |
![]() | Domain d1qsee2: 1qse E:119-246 [21577] Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb_, d1qsed1, d1qsee1 |
PDB Entry: 1qse (more details), 2.8 Å
SCOP Domain Sequences for d1qsee2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsee2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgrad
Timeline for d1qsee2: