Lineage for d1qsee2 (1qse E:119-246)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 9314Protein T-cell antigen receptor [49125] (4 species)
  7. 9321Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (6 PDB entries)
  8. 9326Domain d1qsee2: 1qse E:119-246 [21577]
    Other proteins in same PDB: d1qsea1, d1qsea2, d1qseb1, d1qsed1, d1qsee1

Details for d1qsee2

PDB Entry: 1qse (more details), 2.8 Å

PDB Description: structure of human a6-tcr bound to hla-a2 complexed with altered htlv- 1 tax peptide v7r

SCOP Domain Sequences for d1qsee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsee2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOP Domain Coordinates for d1qsee2:

Click to download the PDB-style file with coordinates for d1qsee2.
(The format of our PDB-style files is described here.)

Timeline for d1qsee2: