SCOP 1.57: Domain d1qrne2: 1qrn E:119-246

Lineage for d1qrne2 (1qrn E:119-246)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (6 PDB entries)

8. Domain d1qrne2: 1qrn E:119-246 [21576]
   Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb1, d1qrnd1, d1qrne1

Details for d1qrne2

PDB Entry: 1qrn, 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a

SCOP Domain Sequences for d1qrne2:

Sequence; same for both SEQRES and ATOM records:

>d1qrne2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
lknvfppevavfepsaeeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Timeline for d1qrne2:

• d1qrne2 first appeared (with stable ids) in SCOP 1.55
  
• d1qrne2 appears in SCOP 1.59
  
• d1qrne2 appears in the current release, SCOPe 2.08