Lineage for d3re7l_ (3re7 L:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728504Protein automated matches [190041] (24 species)
    not a true protein
  7. 1728574Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries)
  8. 1728687Domain d3re7l_: 3re7 L: [215759]
    automated match to d3ka4a_
    complexed with cu

Details for d3re7l_

PDB Entry: 3re7 (more details), 2.82 Å

PDB Description: copper (ii) loaded bullfrog ferritin m chain
PDB Compounds: (L:) Ferritin, middle subunit

SCOPe Domain Sequences for d3re7l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3re7l_ a.25.1.1 (L:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk

SCOPe Domain Coordinates for d3re7l_:

Click to download the PDB-style file with coordinates for d3re7l_.
(The format of our PDB-style files is described here.)

Timeline for d3re7l_: