SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3re7i_ (3re7 I:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1989355Protein automated matches [190041] (26 species)
    not a true protein
  7. 1989425Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries)
  8. 1989535Domain d3re7i_: 3re7 I: [215756]
    automated match to d3ka4a_
    complexed with cu

Details for d3re7i_

PDB Entry: 3re7 (more details), 2.82 Å

PDB Description: Copper (II) loaded Bullfrog Ferritin M chain
PDB Compounds: (I:) Ferritin, middle subunit

SCOPe Domain Sequences for d3re7i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3re7i_ a.25.1.1 (I:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk

SCOPe Domain Coordinates for d3re7i_:

Click to download the PDB-style file with coordinates for d3re7i_.
(The format of our PDB-style files is described here.)

Timeline for d3re7i_: