SCOPe 2.06: Domain d1ao7e2: 1ao7 E:119-246

Lineage for d1ao7e2 (1ao7 E:119-246)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)
Domain d1ao7e2: 1ao7 E:119-246 [21575]
Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b2, d1ao7b3, d1ao7d_, d1ao7e1
complexed with emc

Details for d1ao7e2

PDB Entry: 1ao7 (more details), 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201

PDB Compounds: (E:) t cell receptor beta

SCOPe Domain Sequences for d1ao7e2:

Sequence, based on SEQRES records: (download)

>d1ao7e2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Sequence, based on observed residues (ATOM records): (download)

>d1ao7e2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavflvclatgfypdhvelswwvngkevhsgvstdpqplyalssrlrvsatf
wqnprnhfrcqvqfyglakpvtqivsaeawgrad

SCOPe Domain Coordinates for d1ao7e2:

Click to download the PDB-style file with coordinates for d1ao7e2.
(The format of our PDB-style files is described here.)

Timeline for d1ao7e2: