Lineage for d1ao7e2 (1ao7 E:119-246)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294107Protein T-cell antigen receptor [49125] (7 species)
  7. 1294138Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (31 PDB entries)
  8. 1294183Domain d1ao7e2: 1ao7 E:119-246 [21575]
    Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b_, d1ao7d_, d1ao7e1
    complexed with emc

Details for d1ao7e2

PDB Entry: 1ao7 (more details), 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201
PDB Compounds: (E:) t cell receptor beta

SCOPe Domain Sequences for d1ao7e2:

Sequence, based on SEQRES records: (download)

>d1ao7e2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Sequence, based on observed residues (ATOM records): (download)

>d1ao7e2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavflvclatgfypdhvelswwvngkevhsgvstdpqplyalssrlrvsatf
wqnprnhfrcqvqfyglakpvtqivsaeawgrad

SCOPe Domain Coordinates for d1ao7e2:

Click to download the PDB-style file with coordinates for d1ao7e2.
(The format of our PDB-style files is described here.)

Timeline for d1ao7e2: