| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (31 PDB entries) |
| Domain d1ao7e2: 1ao7 E:119-246 [21575] Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b_, d1ao7d_, d1ao7e1 complexed with emc |
PDB Entry: 1ao7 (more details), 2.6 Å
SCOPe Domain Sequences for d1ao7e2:
Sequence, based on SEQRES records: (download)
>d1ao7e2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad
>d1ao7e2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavflvclatgfypdhvelswwvngkevhsgvstdpqplyalssrlrvsatf
wqnprnhfrcqvqfyglakpvtqivsaeawgrad
Timeline for d1ao7e2:
View in 3DDomains from other chains: (mouse over for more information) d1ao7a1, d1ao7a2, d1ao7b_, d1ao7d_ |