SCOP 1.61: Domain d1ao7e2: 1ao7 E:119-246

Lineage for d1ao7e2 (1ao7 E:119-246)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (8 PDB entries)

8. Domain d1ao7e2: 1ao7 E:119-246 [21575]
   Other proteins in same PDB: d1ao7a1, d1ao7a2, d1ao7b1, d1ao7d_, d1ao7e1

Details for d1ao7e2

PDB Entry: 1ao7, 2.6 Å

PDB Description: complex between human t-cell receptor, viral peptide (tax), and hla-a 0201

SCOP Domain Sequences for d1ao7e2:

Sequence, based on SEQRES records:

>d1ao7e2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Sequence, based on observed residues (ATOM records):

>d1ao7e2 b.1.1.2 (E:119-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
lknvfppevavflvclatgfypdhvelswwvngkevhsgvstdpqplyalssrlrvsatf
wqnprnhfrcqvqfyglakpvtqivsaeawgrad

Timeline for d1ao7e2:

• d1ao7e2 first appeared (with stable ids) in SCOP 1.55
  
• d1ao7e2 appears in SCOP 1.59
  
• d1ao7e2 appears in SCOP 1.63
  
• d1ao7e2 appears in the current release, SCOPe 2.08