SCOPe 2.07: Domain d3re5a1: 3re5 A:13-135

Lineage for d3re5a1 (3re5 A:13-135)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries)

8. Domain d3re5a1: 3re5 A:13-135 [215746]
   Other proteins in same PDB: d3re5a2
   automated match to d1mm9a_
   complexed with 1pe, gol

Details for d3re5a1

PDB Entry: 3re5, 1.95 Å

PDB Description: crystal structure of r4-6 streptavidin

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d3re5a1:

Sequence; same for both SEQRES and ATOM records:

>d3re5a1 b.61.1.1 (A:13-135) automated matches {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstlivtagadgaltgtyesavgnaessyvltgrydsapatdgsgta
lgwtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtftk
vkp

Timeline for d3re5a1:

• d3re5a1 first appeared in SCOPe 2.03, called d3re5a_
  
• d3re5a1 appears in SCOPe 2.06
  
• d3re5a1 appears in the current release, SCOPe 2.08