Lineage for d3rdxb_ (3rdx B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325093Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1325094Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1325401Protein automated matches [190191] (2 species)
    not a true protein
  7. 1325474Species Streptomyces avidinii [TaxId:1895] [189343] (24 PDB entries)
  8. 1325514Domain d3rdxb_: 3rdx B: [215745]
    automated match to d1mm9a_
    complexed with gol

Details for d3rdxb_

PDB Entry: 3rdx (more details), 2.1 Å

PDB Description: crystal structure of ligand-free r7-2 streptavidin
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d3rdxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdxb_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
mtaeagitgtwynqlgstlivtagadgaltgtyesavgnaegsyvltgrydsapatdgsg
talgwtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtf
tkvkp

SCOPe Domain Coordinates for d3rdxb_:

Click to download the PDB-style file with coordinates for d3rdxb_.
(The format of our PDB-style files is described here.)

Timeline for d3rdxb_: