Lineage for d3rdwb_ (3rdw B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880577Species Yersinia pestis [TaxId:214092] [226115] (1 PDB entry)
  8. 2880579Domain d3rdwb_: 3rdw B: [215743]
    automated match to d3l78a_
    complexed with so4

Details for d3rdwb_

PDB Entry: 3rdw (more details), 2.2 Å

PDB Description: putative arsenate reductase from yersinia pestis
PDB Compounds: (B:) Putative arsenate reductase

SCOPe Domain Sequences for d3rdwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdwb_ c.47.1.0 (B:) automated matches {Yersinia pestis [TaxId: 214092]}
dvtiyhnprcsksretlalveqqgitpqvvlyletppsvdklkellqqlgfsdarqlmrt
kedlyktlnlddrgltqdqllqamadnpklierpivvtqgkarigrppeqvlei

SCOPe Domain Coordinates for d3rdwb_:

Click to download the PDB-style file with coordinates for d3rdwb_.
(The format of our PDB-style files is described here.)

Timeline for d3rdwb_: