| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Yersinia pestis [TaxId:214092] [226115] (1 PDB entry) |
| Domain d3rdwa_: 3rdw A: [215742] automated match to d3l78a_ complexed with so4 |
PDB Entry: 3rdw (more details), 2.2 Å
SCOPe Domain Sequences for d3rdwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rdwa_ c.47.1.0 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
dvtiyhnprcsksretlalveqqgitpqvvlyletppsvdklkellqqlgfsdarqlmrt
kedlyktlnlddrgltqdqllqamadnpklierpivvtqgkarigrppeqvleil
Timeline for d3rdwa_: