![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
![]() | Protein automated matches [190191] (2 species) not a true protein |
![]() | Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries) |
![]() | Domain d3rdua1: 3rdu A:13-135 [215741] Other proteins in same PDB: d3rdua2 automated match to d1mm9a_ complexed with 1pe, gol |
PDB Entry: 3rdu (more details), 1.5 Å
SCOPe Domain Sequences for d3rdua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rdua1 b.61.1.1 (A:13-135) automated matches {Streptomyces avidinii [TaxId: 1895]} aeagitgtwynqlgstlivtagadgaltgtyesavgnaegsyvltgrydsapatdgsgta lgwtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtftk vkp
Timeline for d3rdua1: