Lineage for d3rdua_ (3rdu A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1552675Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1552676Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1552677Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1552986Protein automated matches [190191] (2 species)
    not a true protein
  7. 1553062Species Streptomyces avidinii [TaxId:1895] [189343] (30 PDB entries)
  8. 1553076Domain d3rdua_: 3rdu A: [215741]
    automated match to d1mm9a_
    complexed with 1pe, gol

Details for d3rdua_

PDB Entry: 3rdu (more details), 1.5 Å

PDB Description: crystal structure of r7-2 streptavidin complexed with peg
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d3rdua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdua_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
taeagitgtwynqlgstlivtagadgaltgtyesavgnaegsyvltgrydsapatdgsgt
algwtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtft
kvkp

SCOPe Domain Coordinates for d3rdua_:

Click to download the PDB-style file with coordinates for d3rdua_.
(The format of our PDB-style files is described here.)

Timeline for d3rdua_: