SCOPe 2.03: Domain d3rdua_: 3rdu A:

Lineage for d3rdua_ (3rdu A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (24 PDB entries)

8. Domain d3rdua_: 3rdu A: [215741]
   automated match to d1mm9a_
   complexed with 1pe, gol

Details for d3rdua_

PDB Entry: 3rdu, 1.5 Å

PDB Description: crystal structure of r7-2 streptavidin complexed with peg

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d3rdua_:

Sequence; same for both SEQRES and ATOM records:

>d3rdua_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
taeagitgtwynqlgstlivtagadgaltgtyesavgnaegsyvltgrydsapatdgsgt
algwtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtft
kvkp

Timeline for d3rdua_:

• d3rdua_ is new in SCOPe 2.03-stable
  
• d3rdua_ appears in SCOPe 2.04
  
• d3rdua_ appears in the current release, SCOPe 2.08, called d3rdua1