Lineage for d3rdsa1 (3rds A:13-134)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2396658Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2396659Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2396981Protein automated matches [190191] (2 species)
    not a true protein
  7. 2397072Species Streptomyces avidinii [TaxId:1895] [189343] (61 PDB entries)
  8. 2397100Domain d3rdsa1: 3rds A:13-134 [215740]
    Other proteins in same PDB: d3rdsa2
    automated match to d1mm9a_
    complexed with 1pe

Details for d3rdsa1

PDB Entry: 3rds (more details), 1.5 Å

PDB Description: crystal structure of the refolded r7-2 streptavidin
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d3rdsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdsa1 b.61.1.1 (A:13-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstlivtagadgaltgtyesavgnaegsyvltgrydsapatdgsgta
lgwtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtftk
vk

SCOPe Domain Coordinates for d3rdsa1:

Click to download the PDB-style file with coordinates for d3rdsa1.
(The format of our PDB-style files is described here.)

Timeline for d3rdsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rdsa2