Lineage for d1bd2e2 (1bd2 E:119-247)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 935079Protein T-cell antigen receptor [49125] (6 species)
  7. 935105Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
  8. 935129Domain d1bd2e2: 1bd2 E:119-247 [21574]
    Other proteins in same PDB: d1bd2a1, d1bd2a2, d1bd2b_, d1bd2d1, d1bd2e1

Details for d1bd2e2

PDB Entry: 1bd2 (more details), 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201
PDB Compounds: (E:) t cell receptor beta

SCOPe Domain Sequences for d1bd2e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd2e2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d1bd2e2:

Click to download the PDB-style file with coordinates for d1bd2e2.
(The format of our PDB-style files is described here.)

Timeline for d1bd2e2: