Lineage for d1bd2e2 (1bd2 E:119-247)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 104617Protein T-cell antigen receptor [49125] (6 species)
  7. 104624Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (6 PDB entries)
  8. 104625Domain d1bd2e2: 1bd2 E:119-247 [21574]
    Other proteins in same PDB: d1bd2a1, d1bd2a2, d1bd2b1, d1bd2d1, d1bd2e1

Details for d1bd2e2

PDB Entry: 1bd2 (more details), 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201

SCOP Domain Sequences for d1bd2e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd2e2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOP Domain Coordinates for d1bd2e2:

Click to download the PDB-style file with coordinates for d1bd2e2.
(The format of our PDB-style files is described here.)

Timeline for d1bd2e2: