SCOPe 2.08: Domain d3rdqa1: 3rdq A:12-134

Lineage for d3rdqa1 (3rdq A:12-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d3rdqa1: 3rdq A:12-134 [215739]
   Other proteins in same PDB: d3rdqa2
   automated match to d1mm9a_
   complexed with dtb, gol, na, ni

Details for d3rdqa1

PDB Entry: 3rdq, 1.6 Å

PDB Description: crystal structure of r7-2 streptavidin complexed with desthiobiotin

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d3rdqa1:

Sequence; same for both SEQRES and ATOM records:

>d3rdqa1 b.61.1.1 (A:12-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
taeagitgtwynqlgstlivtagadgaltgtyesavgnaegsyvltgrydsapatdgsgt
algwtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtft
kvk

Timeline for d3rdqa1:

• d3rdqa1 first appeared in SCOPe 2.03
  
• d3rdqa1 appears in SCOPe 2.07