Lineage for d3rdia2 (3rdi A:138-207)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1722954Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries)
  8. 1722981Domain d3rdia2: 3rdi A:138-207 [215734]
    Other proteins in same PDB: d3rdia1, d3rdib1
    automated match to d1i5za1
    complexed with cmp

Details for d3rdia2

PDB Entry: 3rdi (more details), 2.95 Å

PDB Description: domain-domain flexibility leads to allostery within the camp receptor protein (crp)
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d3rdia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdia2 a.4.5.0 (A:138-207) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d3rdia2:

Click to download the PDB-style file with coordinates for d3rdia2.
(The format of our PDB-style files is described here.)

Timeline for d3rdia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rdia1