Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (22 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [226114] (1 PDB entry) |
Domain d3rcma_: 3rcm A: [215722] automated match to d1xwya1 complexed with act, cit, zn |
PDB Entry: 3rcm (more details), 2.05 Å
SCOPe Domain Sequences for d3rcma_:
Sequence, based on SEQRES records: (download)
>d3rcma_ c.1.9.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]} mqlidigvnltnssfhdqqaaiveraleagvtqmlltgtslavseqalelcqqldasgah lfatagvhphdakawdtdserqlrlllseprvravgecgldfnrdfsprplqekaleaql tlaaqlrlpvflherdaserllailkdyrdhltgavvhcftgerealfayldldlhigit gwicderrgthlhplvgnipegrlmlesdapyllprslrpkpksgrnepaflpevlreva lhrgesaehtaahttatardffqlpaenlyfqshhhhhhwshpqfek
>d3rcma_ c.1.9.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]} mqlidigvnltnssfhdqqaaiveraleagvtqmlltgtslavseqalelcqqldasgah lfatagvhphdakawdtdserqlrlllseprvravgecgldfnrdfsprplqekaleaql tlaaqlrlpvflherdaserllailkdyrdhltgavvhcftgerealfayldldlhigit gwicderrgthlhplvgnipegrlmlesdapyllprslrpkpksgrnepaflpevlreva lhrgesaehtaahttatardffqlpaenhhhwshpqfek
Timeline for d3rcma_: