Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species) AGC group; PBK subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [90037] (25 PDB entries) Uniprot O15530 75-363 |
Domain d3rcja_: 3rcj A: [215720] automated match to d4eopc_ complexed with 3rc |
PDB Entry: 3rcj (more details), 1.7 Å
SCOPe Domain Sequences for d3rcja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rcja_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} krpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdvmsr ldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsaleyl hgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspellte ksackssdlwalgciiyqlvaglppfragneglifakiikleydfpekffpkardlvekl lvldatkrlgceemegygplkahpffesvtwenlhqqtppkl
Timeline for d3rcja_: