Lineage for d3rcja_ (3rcj A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218180Protein 3-phosphoinositide dependent protein kinase-1 Pdk1 [90036] (1 species)
    AGC group; PBK subfamily; serine/threonine kinase
  7. 2218181Species Human (Homo sapiens) [TaxId:9606] [90037] (25 PDB entries)
    Uniprot O15530 75-363
  8. 2218183Domain d3rcja_: 3rcj A: [215720]
    automated match to d4eopc_
    complexed with 3rc

Details for d3rcja_

PDB Entry: 3rcj (more details), 1.7 Å

PDB Description: Rapid preparation of triazolyl substituted NH-heterocyclic kinase inhibitors via one-pot Sonogashira coupling TMS-deprotection CuAAC sequence
PDB Compounds: (A:) 3-phosphoinositide-dependent protein kinase 1

SCOPe Domain Sequences for d3rcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rcja_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}
krpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdvmsr
ldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsaleyl
hgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspellte
ksackssdlwalgciiyqlvaglppfragneglifakiikleydfpekffpkardlvekl
lvldatkrlgceemegygplkahpffesvtwenlhqqtppkl

SCOPe Domain Coordinates for d3rcja_:

Click to download the PDB-style file with coordinates for d3rcja_.
(The format of our PDB-style files is described here.)

Timeline for d3rcja_: