Lineage for d3rcix_ (3rci X:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325683Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1325684Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1325685Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1325867Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)
  7. 1325868Species Human (Homo sapiens) [TaxId:9606] [141512] (25 PDB entries)
    Uniprot P30405 44-207
  8. 1325884Domain d3rcix_: 3rci X: [215719]
    automated match to d3rdax_
    complexed with m3i

Details for d3rcix_

PDB Entry: 3rci (more details), 1.44 Å

PDB Description: human cyclophilin d complexed with 5-methyl-1,2-oxazol-3-amine
PDB Compounds: (X:) Peptidyl-prolyl cis-trans isomerase F, mitochondrial

SCOPe Domain Sequences for d3rcix_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rcix_ b.62.1.1 (X:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

SCOPe Domain Coordinates for d3rcix_:

Click to download the PDB-style file with coordinates for d3rcix_.
(The format of our PDB-style files is described here.)

Timeline for d3rcix_: