![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries) |
![]() | Domain d3rbcu_: 3rbc U: [215713] automated match to d3ka4a_ complexed with fe |
PDB Entry: 3rbc (more details), 2.7 Å
SCOPe Domain Sequences for d3rbcu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rbcu_ a.25.1.1 (U:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]} mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
Timeline for d3rbcu_: