Lineage for d3rbcs_ (3rbc S:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1485319Protein automated matches [190041] (24 species)
    not a true protein
  7. 1485389Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (18 PDB entries)
  8. 1485449Domain d3rbcs_: 3rbc S: [215711]
    automated match to d3ka4a_
    complexed with fe

Details for d3rbcs_

PDB Entry: 3rbc (more details), 2.7 Å

PDB Description: Bullfrog M ferritin with iron(III) bound to the ferroxidase site
PDB Compounds: (S:) Ferritin, middle subunit

SCOPe Domain Sequences for d3rbcs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rbcs_ a.25.1.1 (S:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk

SCOPe Domain Coordinates for d3rbcs_:

Click to download the PDB-style file with coordinates for d3rbcs_.
(The format of our PDB-style files is described here.)

Timeline for d3rbcs_: