| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein T-cell antigen receptor [49125] (6 species) |
| Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries) |
| Domain d1g6rb2: 1g6r B:118-247 [21571] Other proteins in same PDB: d1g6ra1, d1g6rb1, d1g6rc1, d1g6rd1, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl_, d1g6rm_ |
PDB Entry: 1g6r (more details), 2.8 Å
SCOP Domain Sequences for d1g6rb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6rb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc
Timeline for d1g6rb2: