Lineage for d2ckbd2 (2ckb D:118-247)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1109120Protein T-cell antigen receptor [49125] (6 species)
  7. 1109222Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 1109244Domain d2ckbd2: 2ckb D:118-247 [21570]
    Other proteins in same PDB: d2ckba1, d2ckbb1, d2ckbc1, d2ckbd1, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl_, d2ckbm_

Details for d2ckbd2

PDB Entry: 2ckb (more details), 3 Å

PDB Description: structure of the 2c/kb/dev8 complex
PDB Compounds: (D:) alpha, beta t cell receptor

SCOPe Domain Sequences for d2ckbd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbd2 b.1.1.2 (D:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

SCOPe Domain Coordinates for d2ckbd2:

Click to download the PDB-style file with coordinates for d2ckbd2.
(The format of our PDB-style files is described here.)

Timeline for d2ckbd2: