Lineage for d2ckbd2 (2ckb D:118-247)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 454519Protein T-cell antigen receptor [49125] (6 species)
  7. 454565Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (11 PDB entries)
  8. 454581Domain d2ckbd2: 2ckb D:118-247 [21570]
    Other proteins in same PDB: d2ckba1, d2ckbb1, d2ckbc1, d2ckbd1, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl_, d2ckbm_

Details for d2ckbd2

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckbd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbd2 b.1.1.2 (D:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

SCOP Domain Coordinates for d2ckbd2:

Click to download the PDB-style file with coordinates for d2ckbd2.
(The format of our PDB-style files is described here.)

Timeline for d2ckbd2: