Lineage for d3rbaa_ (3rba A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860553Species Mycobacterium tuberculosis [TaxId:1773] [110492] (7 PDB entries)
    Uniprot Q50452
  8. 2860554Domain d3rbaa_: 3rba A: [215692]
    automated match to d1tfua_
    complexed with cod

Details for d3rbaa_

PDB Entry: 3rba (more details), 1.59 Å

PDB Description: Phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis complexed with DPCoA
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3rbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rbaa_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Mycobacterium tuberculosis [TaxId: 1773]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrln

SCOPe Domain Coordinates for d3rbaa_:

Click to download the PDB-style file with coordinates for d3rbaa_.
(The format of our PDB-style files is described here.)

Timeline for d3rbaa_: