Lineage for d3raob1 (3rao B:2-348)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089162Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2089216Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2089217Protein automated matches [190849] (8 species)
    not a true protein
  7. 2089218Species Bacillus cereus [TaxId:222523] [226123] (1 PDB entry)
  8. 2089220Domain d3raob1: 3rao B:2-348 [215691]
    Other proteins in same PDB: d3raoa2, d3raob2
    automated match to d1nqka_
    complexed with so4

Details for d3raob1

PDB Entry: 3rao (more details), 2.3 Å

PDB Description: crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987.
PDB Compounds: (B:) Putative Luciferase-like Monooxygenase

SCOPe Domain Sequences for d3raob1:

Sequence, based on SEQRES records: (download)

>d3raob1 c.1.16.0 (B:2-348) automated matches {Bacillus cereus [TaxId: 222523]}
eygfwlpifggwlrnvndesmpptfeyakqtaqaaeqlgfsttliaelnlndikgvsaps
leawttaaalaavtdrleimtavrpgfhnpavtakmaanidqlsngrftlnvvsawweee
akqyggvftahderydrteefvtilkglwkeeefsykgnfyelhhthlspkpvqkqgikl
yaggeskrgkevivnhadayvmhggtveevsvkiedmknrrkkvteeplqsfglaayvic
rhteeealeewrritdvkddalgyagyqdfvsksqleqqvklndysvsnrglrpnligtp
eqiaerilafekvgvtllllqfspqleemkrfsekvmplveakrkel

Sequence, based on observed residues (ATOM records): (download)

>d3raob1 c.1.16.0 (B:2-348) automated matches {Bacillus cereus [TaxId: 222523]}
eygfwlpifggwlrnvndesmpptfeyakqtaqaaeqlgfsttliaelnlndikgvsaps
leawttaaalaavtdrleimtavrpgfhnpavtakmaanidqlsngrftlnvvsawweee
akqyggvftahderydrteefvtilkglwkeeefsykgnfyelhhthlspkpvqkqgikl
yaggeskrgkevivnhadayvmhggtveevsvkiedmknrrkkvteeplqsfglaayvic
rhteeealeewrritdvkalgyagyqdfvsksqleqqvklndysvsnrglrpnligtpeq
iaerilafekvgvtllllqfspqleemkrfsekvmplveakrkel

SCOPe Domain Coordinates for d3raob1:

Click to download the PDB-style file with coordinates for d3raob1.
(The format of our PDB-style files is described here.)

Timeline for d3raob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3raob2