![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein T-cell antigen receptor [49125] (6 species) |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries) |
![]() | Domain d2ckbb2: 2ckb B:118-247 [21569] Other proteins in same PDB: d2ckba1, d2ckbb1, d2ckbc1, d2ckbd1, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl_, d2ckbm_ |
PDB Entry: 2ckb (more details), 3.2 Å
SCOP Domain Sequences for d2ckbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckbb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain} dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgradc
Timeline for d2ckbb2: