SCOPe 2.04: Domain d3ra7m2: 3ra7 M:108-211

Lineage for d3ra7m2 (3ra7 M:108-211)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d3ra7m2: 3ra7 M:108-211 [215682]
   Other proteins in same PDB: d3ra7l1, d3ra7m1
   automated match to d1dqdl2
   complexed with dog

Details for d3ra7m2

PDB Entry: 3ra7, 2.8 Å

PDB Description: Bispecific digoxigenin binding antibodies for targeted payload delivery

PDB Compounds: (M:) Fab fragment, light chain

SCOPe Domain Sequences for d3ra7m2:

Sequence; same for both SEQRES and ATOM records:

>d3ra7m2 b.1.1.2 (M:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d3ra7m2:

• d3ra7m2 first appeared in SCOPe 2.03
  
• d3ra7m2 appears in SCOPe 2.05
  
• d3ra7m2 appears in the current release, SCOPe 2.08