SCOP 1.61: Domain d1nfdd2: 1nfd D:118-247

Lineage for d1nfdd2 (1nfd D:118-247)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries)

8. Domain d1nfdd2: 1nfd D:118-247 [21568]
   Other proteins in same PDB: d1nfda1, d1nfdb1, d1nfdc1, d1nfdd1, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2

Details for d1nfdd2

PDB Entry: 1nfd, 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfdd2:

Sequence; same for both SEQRES and ATOM records:

>d1nfdd2 b.1.1.2 (D:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

Timeline for d1nfdd2:

• d1nfdd2 first appeared (with stable ids) in SCOP 1.55
  
• d1nfdd2 appears in SCOP 1.59
  
• d1nfdd2 appears in SCOP 1.63
  
• d1nfdd2 appears in the current release, SCOPe 2.08