Lineage for d3r9pb2 (3r9p B:187-387)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373584Species Mycobacterium avium [TaxId:1770] [226122] (1 PDB entry)
  8. 1373588Domain d3r9pb2: 3r9p B:187-387 [215678]
    automated match to d1g99a2
    complexed with edo, gol, pge

Details for d3r9pb2

PDB Entry: 3r9p (more details), 1.9 Å

PDB Description: crystal structure of acka from mycobacterium paratuberculosis atcc baa-968 / k-10
PDB Compounds: (B:) AckA

SCOPe Domain Sequences for d3r9pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r9pb2 c.55.1.0 (B:187-387) automated matches {Mycobacterium avium [TaxId: 1770]}
plrglkqivlhlgngcsasaiagtrpldtsmgltpleglvmgtrsgdidpsivsylchta
gmgvddvesmlnhrsgvvglsgvrdfrrlreliesgdgaaqlaysvfthrlrkyigayla
vlghtdvisftagigendaavrrdavsgmeelgivlderrnlaggkgarqisaddspitv
lvvptneelaiardcvrvlgg

SCOPe Domain Coordinates for d3r9pb2:

Click to download the PDB-style file with coordinates for d3r9pb2.
(The format of our PDB-style files is described here.)

Timeline for d3r9pb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r9pb1