Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Mycobacterium avium [TaxId:1770] [226122] (1 PDB entry) |
Domain d3r9pa1: 3r9p A:8-186 [215675] automated match to d1g99a1 complexed with edo, gol, pge |
PDB Entry: 3r9p (more details), 1.9 Å
SCOPe Domain Sequences for d3r9pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r9pa1 c.55.1.0 (A:8-186) automated matches {Mycobacterium avium [TaxId: 1770]} rrvlvinsgssslkfqlvdpefgvaastgiverigeesspvpdhdaalrrafdmlagdgv dlntaglvavghrvvhggntfyrptvlddaviarlhelselaplhnppalqgievarrll pdiahvavfdtgffhdlppaaatyaidreladrwqirrygfhgtshryvseqaaafldr
Timeline for d3r9pa1: