Lineage for d3r9ka1 (3r9k A:1-224)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920326Species Bacteroides thetaiotaomicron [TaxId:818] [189385] (21 PDB entries)
  8. 2920347Domain d3r9ka1: 3r9k A:1-224 [215672]
    Other proteins in same PDB: d3r9ka2
    automated match to d2hi0a_
    complexed with so4; mutant

Details for d3r9ka1

PDB Entry: 3r9k (more details), 1.8 Å

PDB Description: crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asp mutant complexed with sulfate, a closed cap conformation
PDB Compounds: (A:) putative Beta-phosphoglucomutase

SCOPe Domain Sequences for d3r9ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r9ka1 c.108.1.0 (A:1-224) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
mrkklkavlfdmdgvlfnsmpyhseawhqvmkthgldlsreeaymhdgrtgastinivfq
relgkeatqeeiesiyheksilfnsypeaermpgawellqkvksegltpmvvtgsgqlsl
lerlehnfpgmfhkelmvtafdvkygkpnpepylmalkkgglkadeavvienaplgveag
hkagiftiavntgpldgqvlldagadllfpsmqtlcdswdtiml

SCOPe Domain Coordinates for d3r9ka1:

Click to download the PDB-style file with coordinates for d3r9ka1.
(The format of our PDB-style files is described here.)

Timeline for d3r9ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r9ka2