| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
| Domain d1jckc2: 1jck C:118-246 [21566] Other proteins in same PDB: d1jcka1, d1jckb1, d1jckb2, d1jckc1, d1jckd1, d1jckd2 |
PDB Entry: 1jck (more details), 3.5 Å
SCOPe Domain Sequences for d1jckc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jckc2 b.1.1.2 (C:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad
Timeline for d1jckc2: