Lineage for d1jckc2 (1jck C:118-246)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550341Protein T-cell antigen receptor [49125] (6 species)
  7. 550387Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (11 PDB entries)
  8. 550401Domain d1jckc2: 1jck C:118-246 [21566]
    Other proteins in same PDB: d1jcka1, d1jckb1, d1jckb2, d1jckc1, d1jckd1, d1jckd2
    mutant

Details for d1jckc2

PDB Entry: 1jck (more details), 3.5 Å

PDB Description: t-cell receptor beta chain complexed with sec3 superantigen

SCOP Domain Sequences for d1jckc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jckc2 b.1.1.2 (C:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

SCOP Domain Coordinates for d1jckc2:

Click to download the PDB-style file with coordinates for d1jckc2.
(The format of our PDB-style files is described here.)

Timeline for d1jckc2: