Lineage for d3r8da_ (3r8d A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009172Protein Pregnane x receptor, PXR [63624] (1 species)
  7. 2009173Species Human (Homo sapiens) [TaxId:9606] [63625] (16 PDB entries)
  8. 2009184Domain d3r8da_: 3r8d A: [215657]
    automated match to d1nrla_
    complexed with pnu

Details for d3r8da_

PDB Entry: 3r8d (more details), 2.8 Å

PDB Description: Activation of the Human Nuclear Xenobiotic Receptor PXR by the Reverse Transcriptase-Targeted Anti-HIV Drug PNU-142721
PDB Compounds: (A:) Nuclear receptor subfamily 1 group I member 2

SCOPe Domain Sequences for d3r8da_:

Sequence, based on SEQRES records: (download)

>d3r8da_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgvlssgcelpeslqapsreeaakwsq
vrkdlcslkvslqlrgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvi
syfrdlpiedqisllkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqllle
pmlkfhymlkklqlheeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnr
pqpahrflflkimamltelrsinaqhtqrllriqdihpfatplmqelfgi

Sequence, based on observed residues (ATOM records): (download)

>d3r8da_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]}
glteeqrmmirelmdaqmktfdttfshfknfrlpgkwsqvrkdlcslkvslqlrgedgsv
wnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafe
lcqlrfntvfnaetgtwecgrlsyclefqqlllepmlkfhymlkklqlheeeyvlmqais
lfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqh
tqrllriqdihpfatplmqelfgi

SCOPe Domain Coordinates for d3r8da_:

Click to download the PDB-style file with coordinates for d3r8da_.
(The format of our PDB-style files is described here.)

Timeline for d3r8da_: