SCOPe 2.08: Domain d3r87a_: 3r87 A:

Lineage for d3r87a_ (3r87 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Photobacterium profundum [TaxId:74109] [196962] (2 PDB entries)

8. Domain d3r87a_: 3r87 A: [215656]
   automated match to d4i45a_

Details for d3r87a_

PDB Entry: 3r87, 1.05 Å

PDB Description: Crystal Structure of Orf6 protein from Photobacterium profundum

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3r87a_:

Sequence; same for both SEQRES and ATOM records:

>d3r87a_ d.38.1.0 (A:) automated matches {Photobacterium profundum [TaxId: 74109]}
mskiyhhpvqiyyedtdhsgvvyhpnflkyferarehvidsdklatlwndhglgfavyka
nmifqdgvefaeicdirtsftldgkyktlwrqevwrpgasraavigdiemvcldkekrlq
pvpadilasmma

Timeline for d3r87a_:

• d3r87a_ first appeared in SCOPe 2.03
  
• d3r87a_ appears in SCOPe 2.07