Lineage for d1jcka2 (1jck A:118-246)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024239Protein T-cell antigen receptor [49125] (7 species)
  7. 2024351Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 2024374Domain d1jcka2: 1jck A:118-246 [21565]
    Other proteins in same PDB: d1jcka1, d1jckb1, d1jckb2, d1jckc1, d1jckd1, d1jckd2

Details for d1jcka2

PDB Entry: 1jck (more details), 3.5 Å

PDB Description: t-cell receptor beta chain complexed with sec3 superantigen
PDB Compounds: (A:) 14.3.d t cell antigen receptor

SCOPe Domain Sequences for d1jcka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcka2 b.1.1.2 (A:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

SCOPe Domain Coordinates for d1jcka2:

Click to download the PDB-style file with coordinates for d1jcka2.
(The format of our PDB-style files is described here.)

Timeline for d1jcka2: