![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
![]() | Protein automated matches [226938] (26 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [226788] (3 PDB entries) |
![]() | Domain d3r7le2: 3r7l E:144-290 [215647] automated match to d1ml4a2 complexed with pal, po4 |
PDB Entry: 3r7l (more details), 2.59 Å
SCOPe Domain Sequences for d3r7le2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r7le2 c.78.1.0 (E:144-290) automated matches {Bacillus subtilis [TaxId: 1423]} tfkgltvsihgdikhsrvarsnaevltrlgarvlfsgpsewqdeentfgtyvsmdeaves sdvvmllriqnerhqsavsqegylnkygltveraermkrhaiimhpapvnrgveiddslv eseksrifkqmkngvfirmaviqralq
Timeline for d3r7le2: