SCOPe 2.01: Domain d1tcrb2: 1tcr B:118-247

Lineage for d1tcrb2 (1tcr B:118-247)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)

8. Domain d1tcrb2: 1tcr B:118-247 [21564]
   Other proteins in same PDB: d1tcra1, d1tcrb1
   complexed with nag, so4

Details for d1tcrb2

PDB Entry: 1tcr, 2.5 Å

PDB Description: murine t-cell antigen receptor 2c clone

PDB Compounds: (B:) alpha, beta T-cell receptor (vb8.2db2jb2.4cb2;va3ja58ca)

SCOPe Domain Sequences for d1tcrb2:

Sequence; same for both SEQRES and ATOM records:

>d1tcrb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

Timeline for d1tcrb2:

• d1tcrb2 first appeared (with stable ids) in SCOP 1.55
  
• d1tcrb2 appears in SCOP 1.75
  
• d1tcrb2 appears in SCOPe 2.02
  
• d1tcrb2 appears in the current release, SCOPe 2.08