| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein T-cell antigen receptor [49125] (6 species) |
| Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries) |
| Domain d1tcrb2: 1tcr B:118-247 [21564] Other proteins in same PDB: d1tcra1, d1tcrb1 complexed with fuc, man, nag, so4 |
PDB Entry: 1tcr (more details), 2.5 Å
SCOP Domain Sequences for d1tcrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcrb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc
Timeline for d1tcrb2: