Lineage for d3r7kd1 (3r7k D:23-248)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015740Species Mycobacterium abscessus [TaxId:561007] [226108] (2 PDB entries)
  8. 3015745Domain d3r7kd1: 3r7k D:23-248 [215636]
    Other proteins in same PDB: d3r7ka2, d3r7kb2, d3r7kc2, d3r7kd2
    automated match to d1rx0a2
    complexed with fda, k

Details for d3r7kd1

PDB Entry: 3r7k (more details), 2.5 Å

PDB Description: crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196
PDB Compounds: (D:) Probable acyl CoA dehydrogenase

SCOPe Domain Sequences for d3r7kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r7kd1 e.6.1.0 (D:23-248) automated matches {Mycobacterium abscessus [TaxId: 561007]}
awttperralsqmarsfvereiapklaewehvgeiprdlhlnaaevgllgigfpeevggs
ggnaidsalvteailaaggstgvcaalfthgialphiaangsdalieryvrptlagkmig
slgvtepgagsdvanlrtravregdtyvvngaktfitsgvradfvttavrtggpgyggvs
llvidknspgfevsrrldkmgwrcsdtaelsfvdvrvpadnlvgae

SCOPe Domain Coordinates for d3r7kd1:

Click to download the PDB-style file with coordinates for d3r7kd1.
(The format of our PDB-style files is described here.)

Timeline for d3r7kd1: