![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Mycobacterium abscessus [TaxId:561007] [226109] (2 PDB entries) |
![]() | Domain d3r7kc2: 3r7k C:249-399 [215635] Other proteins in same PDB: d3r7ka1, d3r7kb1, d3r7kc1, d3r7kd1 automated match to d1rx0a1 complexed with fda, k |
PDB Entry: 3r7k (more details), 2.5 Å
SCOPe Domain Sequences for d3r7kc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r7kc2 a.29.3.0 (C:249-399) automated matches {Mycobacterium abscessus [TaxId: 561007]} nsgflqimqqfqaerlgiavqayatagraldlakswareretfgrpltgrqiirhklaem arqvdvactytravmqrwlagedvvaevsmakntavyacdyvvneavqifggmgymrese ierhyrdcrilgigggtneimneviakrigl
Timeline for d3r7kc2: