Lineage for d3r7kb1 (3r7k B:21-248)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1691655Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1691656Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1691797Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1691798Protein automated matches [226934] (17 species)
    not a true protein
  7. 1691869Species Mycobacterium abscessus [TaxId:561007] [226108] (2 PDB entries)
  8. 1691872Domain d3r7kb1: 3r7k B:21-248 [215632]
    Other proteins in same PDB: d3r7ka2, d3r7kb2, d3r7kc2, d3r7kd2
    automated match to d1rx0a2
    complexed with fda, k

Details for d3r7kb1

PDB Entry: 3r7k (more details), 2.5 Å

PDB Description: crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196
PDB Compounds: (B:) Probable acyl CoA dehydrogenase

SCOPe Domain Sequences for d3r7kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r7kb1 e.6.1.0 (B:21-248) automated matches {Mycobacterium abscessus [TaxId: 561007]}
peawttperralsqmarsfvereiapklaewehvgeiprdlhlnaaevgllgigfpeevg
gsggnaidsalvteailaaggstgvcaalfthgialphiaangsdalieryvrptlagkm
igslgvtepgagsdvanlrtravregdtyvvngaktfitsgvradfvttavrtggpgygg
vsllvidknspgfevsrrldkmgwrcsdtaelsfvdvrvpadnlvgae

SCOPe Domain Coordinates for d3r7kb1:

Click to download the PDB-style file with coordinates for d3r7kb1.
(The format of our PDB-style files is described here.)

Timeline for d3r7kb1: